PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009104653.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 546aa    MW: 62679.3 Da    PI: 9.1024
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009104653.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.31.2e-2942126187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++ e+laL+++r+ m++++r++ lk+ lWee+s+km+e g++rs+k+Ckek+en+ k++k++k+g+ ++++++  t+++fd+lea
  XP_009104653.1  42 RWPRPETLALLRIRSVMDKTFRDSTLKASLWEEISRKMMELGYKRSSKKCKEKFENVYKYHKRTKDGRTGKSKGN--TYRFFDELEA 126
                     8********************************************************************975555..6******985 PP

2trihelix96.42.5e-30374459187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r+++e ++ ++  k+plWee+s+ +r+ g++rs k+Ckekwen+nk++kk+ke++k+r + +s+tcp f+qlea
  XP_009104653.1 374 RWPKTEVEALIRIRKNLEANYLENGTKGPLWEEISAEIRRFGYNRSTKRCKEKWENINKYFKKVKESNKRR-PLDSKTCPCFHQLEA 459
                     8********************************************************************97.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.5439101IPR001005SANT/Myb domain
CDDcd122032.08E-2341106No hitNo description
PROSITE profilePS500906.8644199IPR017877Myb-like domain
PfamPF138373.6E-1941126No hitNo description
PROSITE profilePS500907.77367431IPR017877Myb-like domain
SMARTSM007170.0068371433IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-5373466IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-4373430IPR009057Homeodomain-like
CDDcd122031.39E-21373438No hitNo description
PfamPF138372.8E-20373460No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MSGNSSELLD SSGDGGLGGS GEEEKDMKME KTGEACGGRG NRWPRPETLA LLRIRSVMDK  60
TFRDSTLKAS LWEEISRKMM ELGYKRSSKK CKEKFENVYK YHKRTKDGRT GKSKGNTYRF  120
FDELEAFETI NSYPPGSKFQ PAKPPAAAAT TTRQMFHLDV PKTASNQQVS VKPITTNPTF  180
LAKQPSLTTH FPFYNNNHST KVDDTGFKPT SSDLLNNVSS LNLFSRSTSS SDEEEDQEKR  240
SRKKRKLTKE LMEKQEKMHK RFLKALETGE RERISREEAW RVQEVERINS EHNTLVHERS  300
NIAAKDVAII SFLQKISGGQ QQPHQQNYKV SQRKQYQSEQ HSITFESEET SQVVLDTTIM  360
KIGTSNXASP SSSRWPKTEV EALIRIRKNL EANYLENGTK GPLWEEISAE IRRFGYNRST  420
KRCKEKWENI NKYFKKVKES NKRRPLDSKT CPCFHQLEAL YNERNKTGPL PILPLLVNXR  480
QFLLSQETKA EXTNQRDKVD NKEGESGEDD YEDEEEEGAG DNEISEFEIV LNKTSSPMDI  540
NNNLFT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18492KRSSKKCKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.250010.0silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892030.0AC189203.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006H21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104653.10.0PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor GT-2
SwissprotQ391170.0TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLM4CHL90.0M4CHL9_BRARP; Uncharacterized protein
STRINGBra003702.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59952847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.20.0Trihelix family protein